ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb (A23008)

ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb (A23008)

ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb (A23008)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb (Catalog Number: A23008) encodes a member of the immunoglobulin gene superfamily. Expression of this cell surface protein is restricted to B cell lymphocytes.

Store
SKU: A23008 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23008
Product NameABflo® 488 Rabbit anti-Human/Monkey CD19 mAb (A23008)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Gene Name CD19
Protein Name CD19
Gene ID 102145514
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Monkey
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23008: ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb

This gene encodes a member of the immunoglobulin gene superfamily. Expression of this cell surface protein is restricted to B cell lymphocytes. This protein is a reliable marker for pre-B cells but its expression diminishes during terminal B cell differentiation in antibody secreting plasma cells. The protein has two N-terminal extracellular Ig-like domains separated by a non-Ig-like domain, a hydrophobic transmembrane domain, and a large C-terminal cytoplasmic domain. This protein forms a complex with several membrane proteins including complement receptor type 2 (CD21) and tetraspanin (CD81) and this complex reduces the threshold for antigen-initiated B cell activation. Activation of this B-cell antigen receptor complex activates the phosphatidylinositol 3-kinase signalling pathway and the subsequent release of intracellular stores of calcium ions. This protein is a target of chimeric antigen receptor (CAR) T-cells used in the treatment of lymphoblastic leukemia. Mutations in this gene are associated with the disease common variable immunodeficiency 3 (CVID3) which results in a failure of B-cell differentiation and impaired secretion of immunoglobulins. CVID3 is characterized by hypogammaglobulinemia, an inability to mount an antibody response to antigen, and recurrent bacterial infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Immunogen Information about ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb (A23008)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-292 of monkey CD19.
Sequence:PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK
Gene ID:102145514
Swiss prot:
Synonyms:CD19
Calculated MW:63kDa
Observed MW:Refer to figures

Images of ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb (A23008)

Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test, right).

Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Raji cells was used as blank control (red line).

Flow cytometry: 1X10^6 Daudi cells were surface-stained with ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Daudi cells was used as blank control (red line).

Flow cytometry: 1X10^6 293F cells(negative control) were surface-stained with ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained 293F cells was used as blank control (red line).

Flow cytometry:1X10^6 Raji cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test, right).

Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test) or ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test).The cells were simultaneously stained with ABflo® 647 Rabbit anti-Human CD27 mAb(A22064,5 μl/Test).

Flow cytometry:1X10^6 Monkey PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test) or ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test).The cells were simultaneously stained with ABflo® 647 Rabbit anti-Human CD27 mAb(A22064,5 μl/Test).

Please remember our product information: ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb (Catalog Number: A23008) Abclonal

No more offers for this product!