ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)

ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)

ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (Catalog Number: A23175) encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set.

Store
SKU: A23175 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23175
Product NameABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms PTA1; DNAM1; DNAM-1; TLiSA1
Gene Name CD226
Protein Name CD226
Uniprot/Swissprot ID Q15762
Gene ID 10666
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23175: ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb

This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants.

Immunogen Information about ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-247 of human DNAM-1/CD226 (NP_006557.2).
Sequence:EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Gene ID:10666
Swiss prot:Q15762
Synonyms:PTA1; DNAM1; DNAM-1; TLiSA1
Calculated MW:39kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)

Flow cytometry:1X10^6 293F cells (negative control, Left) and HEL cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb(A23175, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb(A23175, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb(A23175, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb(A23175, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (Catalog Number: A23175) Abclonal

No more offers for this product!