ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (Catalog Number: A23175) encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set.
- Details & Specifications
- References
- More Offers
| Catalog No. | A23175 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | PTA1; DNAM1; DNAM-1; TLiSA1 |
| Gene Name | CD226 |
| Protein Name | CD226 |
| Uniprot/Swissprot ID | Q15762 |
| Gene ID | 10666 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23175: ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb
This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants.
Immunogen Information about ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-247 of human DNAM-1/CD226 (NP_006557.2).
Sequence:EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Gene ID:10666
Swiss prot:Q15762
Synonyms:PTA1; DNAM1; DNAM-1; TLiSA1
Calculated MW:39kDa
Observed MW:
Images of ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (A23175)

Flow cytometry:1X10^6 293F cells (negative control, Left) and HEL cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb(A23175, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb(A23175, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb(A23175, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb(A23175, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human DNAM-1/CD226 mAb (Catalog Number: A23175) Abclonal







