ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD79a mAb (Catalog Number: A22300) The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig).
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22300 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD79a mAb (A22300) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | IGA; MB1; MB-1; IGAlpha |
| Gene Name | CD79A |
| Protein Name | CD79A |
| Uniprot/Swissprot ID | P11912 |
| Entrez GeneID | 973 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC(Intra) |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22300: ABflo® 488 Rabbit anti-Human CD79a mAb
The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
Sequence：FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
Gene ID：973
Swiss prot：P11912
Synonyms：IGA; MB1; MB-1; IGAlpha
Calculated MW：25kDa
Observed MW：
Images of ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)
Flow cytometry: 1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Daudi cells was used as blank control (red line).
Flow cytometry: 1X10^6 C2C12 cells(negative control) were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained C2C12 cells was used as blank control (red line).
Flow cytometry:1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD79a mAb (Catalog Number: A22300) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |