ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)

ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)

ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human CD71 mAb (Catalog Number: A22301) encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis.

Store
SKU: A22301 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22301
Product NameABflo® 488 Rabbit anti-Human CD71 mAb (A22301)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Gene Name TFRC
Protein Name TFRC
Uniprot/Swissprot ID P02786
Gene ID 7037
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22301: ABflo® 488 Rabbit anti-Human CD71 mAb

This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71 (NP_003225.2).
Sequence:RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV
Gene ID:7037
Swiss prot:P02786
Synonyms:T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Calculated MW:85kDa
Observed MW:Refer to figures

Images of ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)

Flow cytometry: 1X10^6 SH-SY5Y cells (Low Expression, left) and K-562 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD71 mAb (A22301, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 K-562 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD71 mAb (A22301, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD71 mAb (Catalog Number: A22301) Abclonal

No more offers for this product!