ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD71 mAb (Catalog Number: A22301) encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis.
- Details & Specifications
- References
| Catalog No. | A22301 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD71 mAb (A22301) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46 |
| Gene Name | TFRC |
| Protein Name | TFRC |
| Uniprot/Swissprot ID | P02786 |
| Gene ID | 7037 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22301: ABflo® 488 Rabbit anti-Human CD71 mAb
This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71 (NP_003225.2).
Sequence:RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV
Gene ID:7037
Swiss prot:P02786
Synonyms:T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Calculated MW:85kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)

Flow cytometry: 1X10^6 SH-SY5Y cells (Low Expression, left) and K-562 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD71 mAb (A22301, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 K-562 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD71 mAb (A22301, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD71 mAb (Catalog Number: A22301) Abclonal



