ABflo® 488 Rabbit anti-Human CD7 mAb (A22193)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human CD7 mAb (Catalog Number: A22193) encodes a transmembrane protein which is a member of the immunoglobulin superfamily.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22193 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD7 mAb (A22193) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | GP40; TP41; Tp40; LEU-9 |
| Gene Name | CD7 |
| Protein Name | CD7 |
| Uniprot/Swissprot ID | P09564 |
| Entrez GeneID | 924 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22193: ABflo® 488 Rabbit anti-Human CD7 mAb
This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD7 mAb (A22193)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 26-180 of human CD7 (NP_006128.1).
Sequence：AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Gene ID：924
Swiss prot：P09564
Synonyms：GP40; TP41; Tp40; LEU-9
Calculated MW：25kDa
Observed MW：
Images of ABflo® 488 Rabbit anti-Human CD7 mAb (A22193)
Flow cytometry:1X10^6 A549 cells (negative control, left) and MOLT-4 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD7 mAb(A22193, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human CD7 mAb(A22193, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD7 mAb(A22193, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD7 mAb (Catalog Number: A22193) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |