ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)

ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)

ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (Catalog Number: A22517) Bone marrow stromal cells are involved in the growth and development of B-cells.

Store
SKU: A22517 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22517
Product NameABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD317; HM1.24; TETHERIN
Gene Name BST2
Protein Name BST2
Uniprot/Swissprot ID Q10589
Gene ID 684
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22517: ABflo® 488 Rabbit anti-Human CD317/BST2 mAb

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 49-160 of human CD317/BST2 (NP_004326.1).
Sequence:NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS
Gene ID:684
Swiss prot:Q10589
Synonyms:CD317; HM1.24; TETHERIN
Calculated MW:18kDa/19kDa
Observed MW:Refer to figures

Images of ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)

Flow cytometry:1X10^6 A549 cells (negative control, left) and HeLa cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD317/BST2 mAb(A22517, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Hela cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human BST2 mAb(A22517, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (Catalog Number: A22517) Abclonal

No more offers for this product!