Myeloperoxidase (MPO) Rabbit mAb (A12109)

Myeloperoxidase (MPO) Rabbit mAb (A12109)

Myeloperoxidase (MPO) Rabbit mAb (A12109)

$148.00$548.00

In stock

$148.00$548.00

Abclonal Myeloperoxidase (MPO) Rabbit mAb (Catalog Number: A12109) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules.

Store
SKU: A12109 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A12109
Product NameMyeloperoxidase (MPO) Rabbit mAb (A12109)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Gene Name MPO
Protein Name MPO
Uniprot/Swissprot ID P05164
Gene ID 4353
Clone ARC53227
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A12109: Myeloperoxidase (MPO) Rabbit mAb

Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of neutrophils.

Immunogen Information about Myeloperoxidase (MPO) Rabbit mAb (A12109)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 646-745 of human Myeloperoxidase (MPO) (NP_000241.1).
Sequence:GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS
Gene ID:4353
Swiss prot:P05164
Synonyms:
Calculated MW:84kDa
Observed MW:13kDa

Images of Myeloperoxidase (MPO) Rabbit mAb (A12109)

Western blot analysis of extracts of HL-60 cells, using Myeloperoxidase (MPO) antibody (A12109) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human extranodal NK-T cell lymphoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human hepatocholangiocarcinoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Please remember our product information: Myeloperoxidase (MPO) Rabbit mAb (Catalog Number: A12109) Abclonal

No more offers for this product!