CD68 Rabbit mAb (A22329)

CD68 Rabbit mAb (A22329)

CD68 Rabbit mAb (A22329)

$148.00$548.00

In stock

$148.00$548.00

Abclonal CD68 Rabbit mAb (Catalog Number: A22329) encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family.

Store
SKU: A22329 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22329
Product NameCD68 Rabbit mAb (A22329)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms GP110; LAMP4; SCARD1
Gene Name CD68
Protein Name CD68
Uniprot/Swissprot ID P34810
Gene ID 968
Clone ARC51158
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22329: CD68 Rabbit mAb

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

Immunogen Information about CD68 Rabbit mAb (A22329)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2).
Sequence:TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK
Gene ID:968
Swiss prot:P34810
Synonyms:GP110; LAMP4; SCARD1; CD68
Calculated MW:37kDa
Observed MW:70-80kDa, 130-140kDa

Images of CD68 Rabbit mAb (A22329)

Western blot analysis of various lysates, using CD68 antibody (A22329) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of various lysates, using CD68 antibody (A22329) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded human colon using CD68 Rabbit mAb (A22329) at dilution of 1:70000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD68 Rabbit mAb (A22329) at dilution of 1:70000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: CD68 Rabbit mAb (Catalog Number: A22329) Abclonal