CD35/CR1 Rabbit mAb (A3661)
$148.00 – $548.00
Abclonal CD35/CR1 Rabbit mAb (Catalog Number: A3661) is a member of the receptors of complement activation (RCA) family and is located in the ‘cluster RCA’ region of chromosome 1.
- Details & Specifications
- References
- More Offers
| Catalog No. | A3661 |
|---|---|
| Product Name | CD35/CR1 Rabbit mAb (A3661) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | KN; C3BR; C4BR; CD35 |
| Gene Name | CR1 |
| Protein Name | CR1 |
| Uniprot/Swissprot ID | P17927 |
| Gene ID | 1378 |
| Clone | ARC2065 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A3661: CD35/CR1 Rabbit mAb
This gene is a member of the receptors of complement activation (RCA) family and is located in the ‘cluster RCA’ region of chromosome 1. The genome is polymorphic at this locus with allele-specific splice variants encoding different isoforms, based on the presence/absence of long homologous repeats (LHRs). The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in this gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus, sarcoidosis and Alzheimer’s disease. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria.
Immunogen Information about CD35/CR1 Rabbit mAb (A3661)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1940-2039 of human CD35/CR1 (P17927).
Sequence：DGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
Gene ID：1378
Swiss prot：P17927
Synonyms：KN; C3BR; C4BR; CD35; CD35/CR1
Calculated MW：224kDa
Observed MW：
Images of CD35/CR1 Rabbit mAb (A3661)
Immunohistochemistry analysis of CD35/CR1 in paraffin-embedded human tonsil using CD35/CR1 Rabbit mAb (A3661) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of paraffin-embedded Human tonsil tissue using CD35/CR1 Rabbit mAb (A3661, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Please remember our product information: CD35/CR1 Rabbit mAb (Catalog Number: A3661) Abclonal
