CD35/CR1 Rabbit mAb (A3661)

CD35/CR1 Rabbit mAb (A3661)

CD35/CR1 Rabbit mAb (A3661)

$148.00$548.00

In stock

$148.00$548.00

Abclonal CD35/CR1 Rabbit mAb (Catalog Number: A3661) is a member of the receptors of complement activation (RCA) family and is located in the ‘cluster RCA’ region of chromosome 1.

Store
SKU: A3661 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A3661
Product NameCD35/CR1 Rabbit mAb (A3661)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms KN; C3BR; C4BR; CD35
Gene Name CR1
Protein Name CR1
Uniprot/Swissprot ID P17927
Gene ID 1378
Clone ARC2065
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A3661: CD35/CR1 Rabbit mAb

This gene is a member of the receptors of complement activation (RCA) family and is located in the ‘cluster RCA’ region of chromosome 1. The genome is polymorphic at this locus with allele-specific splice variants encoding different isoforms, based on the presence/absence of long homologous repeats (LHRs). The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in this gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus, sarcoidosis and Alzheimer’s disease. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria.

Immunogen Information about CD35/CR1 Rabbit mAb (A3661)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1940-2039 of human CD35/CR1 (P17927).
Sequence:DGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
Gene ID:1378
Swiss prot:P17927
Synonyms:KN; C3BR; C4BR; CD35; CD35/CR1
Calculated MW:224kDa
Observed MW:

Images of CD35/CR1 Rabbit mAb (A3661)

Immunohistochemistry analysis of CD35/CR1 in paraffin-embedded human tonsil using CD35/CR1 Rabbit mAb (A3661) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Confocal imaging of paraffin-embedded Human tonsil tissue using CD35/CR1 Rabbit mAb (A3661, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Please remember our product information: CD35/CR1 Rabbit mAb (Catalog Number: A3661) Abclonal