ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (A22486)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (Catalog Number: A22486) encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22486 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (A22486) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1 |
| Gene Name | EPCAM |
| Protein Name | EPCAM |
| Uniprot/Swissprot ID | P16422 |
| Entrez GeneID | 4072 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22486: ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (A22486)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 24-265 of human CD326/EPCAM (NP_002345.2).
Sequence：QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Gene ID：4072
Swiss prot：P16422
Synonyms：ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1
Calculated MW：35kDa
Observed MW：
Images of ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (A22486)
Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and HT-29 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (A22486, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 HeLa cells(Low Expression) were surface-stained with ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (A22486, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained HeLa cells was used as blank control (red line).
Flow cytometry: 1X10^6 HT-29 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (A22486, 5 μl/Test, right).
Flow cytometry: 1X10^6 HeLa cells (Low Expression) were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (A22486, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD326/EPCAM mAb (Catalog Number: A22486) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |