IRF4 Rabbit mAb (A23227)
$148.00 – $548.00
Abclonal IRF4 Rabbit mAb (Catalog Number: A23227) encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain.
- Details & Specifications
- References
| Catalog No. | A23227 |
|---|---|
| Product Name | IRF4 Rabbit mAb (A23227) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | MUM1; LSIRF; SHEP8; NF-EM5 |
| Gene Name | IRF4 |
| Protein Name | IRF4 |
| Uniprot/Swissprot ID | Q15306 |
| Gene ID | 3662 |
| Clone | ARC58086 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23227: IRF4 Rabbit mAb
The protein encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain. The IRFs are important in the regulation of interferons in response to infection by virus, and in the regulation of interferon-inducible genes. This family member is lymphocyte specific and negatively regulates Toll-like-receptor (TLR) signaling that is central to the activation of innate and adaptive immune systems. A chromosomal translocation involving this gene and the IgH locus, t(6;14)(p25;q32), may be a cause of multiple myeloma. Alternatively spliced transcript variants have been found for this gene.
Immunogen Information about IRF4 Rabbit mAb (A23227)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 351-451 of human IRF4 (NP_001182215.1).
Sequence：ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Gene ID：3662
Swiss prot：Q15306
Synonyms：MUM1; LSIRF; SHEP8; NF-EM5; IRF4
Calculated MW：52kDa
Observed MW：Refer to figures
Images of IRF4 Rabbit mAb (A23227)
Immunohistochemistry analysis of IRF4 in paraffin-embedded Human anaplastic large cell lymphoma using IRF4 Rabbit mAb (A23227) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IRF4 in paraffin-embedded human appendix using IRF4 Rabbit mAb (A23227) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IRF4 in paraffin-embedded Human mantle cell lymphoma using IRF4 Rabbit mAb (A23227) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IRF4 in paraffin-embedded human tonsil using IRF4 Rabbit mAb (A23227) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: IRF4 Rabbit mAb (Catalog Number: A23227) Abclonal
