TRIM24 Rabbit pAb
$108.00 – $488.00
PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA
SKU: A10546
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A10546 |
|---|---|
| Product Name | TRIM24 Rabbit pAb |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA |
| Summary | Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human;Rat. |
| Gene Name | TRIM24 |
| Gene Full Name | defensin alpha 1 |
| Protein Name | TRIM24 |
| Uniprot/Swissprot ID | O15164 |
| Uniprot ID | P59665 |
| Entrez GeneID | 8805 |
| Clonality | Polyclonal |
| Source/Host | Rabbit |
| Specificity/Sensitivity | No cross reactivity with other proteins. |
| Applications | WB |
| Application Details | Western blot|0.1-0.5 μg/ml|Human, Rat|-| |
| Reactivity | Human |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC). |
| Purification | Immunogen affinity purified. |
| Form Of Antibody | Lyophilized |
| Reconstitution | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
| Contents | A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC). |
| Conjugate | Unconjugated |
| Stability & Storage | At -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freezing and thawing. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains – a RING, a B-box type 1 and a B-box type 2 – and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |
No more offers for this product!