Semaphorin 3A Rabbit pAb
$108.00 – $488.00
HH16; SemD; COLL1; SEMA1; SEMAD; SEMAL; coll-1; Hsema-I; SEMAIII; Hsema-III
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A12967 |
---|---|
Product Name | Semaphorin 3A Rabbit pAb |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | HH16; SemD; COLL1; SEMA1; SEMAD; SEMAL; coll-1; Hsema-I; SEMAIII; Hsema-III |
Summary | Rabbit IgG polyclonal antibody for Alpha-amylase 1(AMY1A|AMY1B|AMY1C) detection. Tested with WB, IHC in Human;Mouse;Rat. |
Gene Name | SEMA3A |
Gene Full Name | amylase, alpha 1A (salivary)|amylase, alpha 1B (salivary)|amylase, alpha 1C (salivary) |
Protein Name | SEMA3A |
Uniprot/Swissprot ID | Q14563 |
Uniprot ID | P04745 |
Entrez GeneID | 10371 |
Clonality | Polyclonal |
Source/Host | Rabbit |
Specificity/Sensitivity | No cross reactivity with other proteins. |
Applications | WB |
Application Details | Western blot|0.1-0.5 μg/ml|Mouse, Rat|Human| Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/ml|Human|-|By Heat |
Paraffin-embedded Section | Concentration: 0.5-1μg/ml; Tested Species: Human |
Reactivity | Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. |
Purification | Immunogen affinity purified. |
Form Of Antibody | Lyophilized |
Reconstitution | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Contents | A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. |
Conjugate | Unconjugated |
Stability & Storage | At -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freezing and thawing. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer’s disease.
Additional information
Ship from Country | USA |
---|---|
Size | 20 ul, 100 ul, 200 ul, 50 ul |