Cytokeratin 20 (CK20) Rabbit mAb (A19041)
$148.00 – $548.00
Abclonal Cytokeratin 20 (CK20) Rabbit mAb (Catalog Number: A19041) encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A19041 |
|---|---|
| Product Name | Cytokeratin 20 (CK20) Rabbit mAb (A19041) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | K20; CD20; CK20; CK-20; KRT21 |
| Gene Name | KRT20 |
| Protein Name | KRT20 |
| Uniprot/Swissprot ID | P35900 |
| Entrez GeneID | 54474 |
| Clone | ARC0288 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | WB, IHC-P |
| Reactivity | Human, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19041: Cytokeratin 20 (CK20) Rabbit mAb
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.
Immunogen Information about Cytokeratin 20 (CK20) Rabbit mAb (A19041)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 325-424 of human Cytokeratin 20 (KRT20) (P35900).
Sequence：LANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI
Gene ID：54474
Swiss prot：P35900
Synonyms：K20; CD20; KRT20; CK-20; KRT21; Cytokeratin 20 (CK20)
Calculated MW：48kDa
Observed MW：44kDa
Images of Cytokeratin 20 (CK20) Rabbit mAb (A19041)
Western blot analysis of extracts of HT-29 cells, using Cytokeratin 20 (KRT20) (KRT20) antibody (A19041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Rat liver, using Cytokeratin 20 (KRT20) (KRT20) antibody (A19041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human stomach using Cytokeratin 20 (CK20) Rabbit mAb (A19041) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: Cytokeratin 20 (CK20) Rabbit mAb (Catalog Number: A19041) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |